Sequence:
download
WP:CE24908sequence.fasta
>UNC-38 MRSFWLFLLLLLFCISFIKLTEGNEDAKRLYDDLMVNYNRHRRPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLK QTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPF DEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGIIDNVTVAEDGIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCP QSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLI GKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLLFMRRPIDDYEEKFDDKKKPKDGKIALSVHA HRVSNVGNNIRNATIDDTIQKMYYSPPVVKAFENICFIAELLKKKDRDDKIDEDWKYVAMVLDRLFLLIFSIACFVGTVI ILLRAPTLYDTRQPIDLQYRPANLSANPISF
view sequence (511 aa)
>UNC-38
MRSFWLFLLLLLFCISFIKLTEGNEDAKRLYDDLMVNYNRHRRPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLK
QTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPF
DEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGIIDNVTVAEDGIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCP
QSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLI
GKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLLFMRRPIDDYEEKFDDKKKPKDGKIALSVHA
HRVSNVGNNIRNATIDDTIQKMYYSPPVVKAFENICFIAELLKKKDRDDKIDEDWKYVAMVLDRLFLLIFSIACFVGTVI
ILLRAPTLYDTRQPIDLQYRPANLSANPISF
Estimated Isoelectric Point:
7.42
Estimated Molecular Weight:
59.4 kD
Amino Acid Composition:
Amino Acid Frequency
Ser32
Phe26
Thr31
Asn24
Lys33
Tyr24
Glu23
Val40
Gln11
Met12
Cys10
Leu61
Ala20
Trp12
Pro29
His8
Asp34
Arg24
Ile44
Gly13