Sequence:
download
WP:CE27109sequence.fasta
>CHO-1 MADLLGIVAIVFFYVLILVVGIWAGRKSKSSKELESEAGAATEEVMLAGRNIGTLVGIFTMTATWVGGAYINGTAEALYN GGLLGCQAPVGYAISLVMGGLLFAKKMREEGYITMLDPFQHKYGQRIGGLMYVPALLGETFWTAAILSALGATLSVILGI DMNASVTLSACIAVFYTFTGGYYAVAYTDVVQLFCIFVGLWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCM LLLVFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSPWNNGTKVESIPPDKRNM VVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAHNIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALT IQSIYGLWYLCADLVYVILFPQLLCVVYMPRSNTYGSLAGYAVGLVLRLIGGEPLVSLPAFFHYPMYTDGVQYFPFRTTA MLSSMATIYIVSIQSEKLFKSGRLSPEWDVMGCVVNIPIDHVPLPSDVSFAVSSETLNMKAPNGTPAPVHPNQQPSDENT LLHPYSDQSYYSTNSN
view sequence (576 aa)
>CHO-1
MADLLGIVAIVFFYVLILVVGIWAGRKSKSSKELESEAGAATEEVMLAGRNIGTLVGIFTMTATWVGGAYINGTAEALYN
GGLLGCQAPVGYAISLVMGGLLFAKKMREEGYITMLDPFQHKYGQRIGGLMYVPALLGETFWTAAILSALGATLSVILGI
DMNASVTLSACIAVFYTFTGGYYAVAYTDVVQLFCIFVGLWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCM
LLLVFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSPWNNGTKVESIPPDKRNM
VVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAHNIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALT
IQSIYGLWYLCADLVYVILFPQLLCVVYMPRSNTYGSLAGYAVGLVLRLIGGEPLVSLPAFFHYPMYTDGVQYFPFRTTA
MLSSMATIYIVSIQSEKLFKSGRLSPEWDVMGCVVNIPIDHVPLPSDVSFAVSSETLNMKAPNGTPAPVHPNQQPSDENT
LLHPYSDQSYYSTNSN
Estimated Isoelectric Point:
6.23
Estimated Molecular Weight:
62.4 kD
Amino Acid Composition:
Amino Acid Frequency
Ser43
Phe24
Thr33
Asn18
Lys16
Tyr27
Glu19
Val53
Gln15
Met24
Cys10
Leu57
Ala56
Trp13
Pro29
His9
Asp19
Arg16
Ile44
Gly51