Sequence:
download
WP:CE33819sequence.fasta
>NHR-14, isoform b MDFLISTSLSESTSTSADFCVVCGDKAIGKHYGAVACNGCKGFFRRSVWQNLQYTCRFNKQCNIDKDHRNACRYCRFQKC LADGMKPEAIQNERDRIGSTKRRKRSGANSENNSDSEGTPSPKIEVMGNSVSRKLIEMLLDIEHRLASNQSMNALLRDES EMKNSRQRAVNYLIGWTNMLHPLPEVPLADKVLLLKKFSSAFTLLGTLQRSMALPHFVLPNDQVLSISASHPPELFEALT RIIDELLTPLRRLRTDHAEFSCLKALLLLNPDVVGISNNTRERIREARDALLKTLFAYMSNTQNSIDASLRVSSLLMIIP SLISVSSSIMEFPALSDLFGLGDVIKRDTISPKIETPPLEMKPMMPKIAQPPVTSAPTVPTNIMMNKDLISQIMNNPQLF PLLPMPQTASPPMSFMGQSYNRNSDVIFSQCPSK
view sequence (434 aa)
>NHR-14, isoform b
MDFLISTSLSESTSTSADFCVVCGDKAIGKHYGAVACNGCKGFFRRSVWQNLQYTCRFNKQCNIDKDHRNACRYCRFQKC
LADGMKPEAIQNERDRIGSTKRRKRSGANSENNSDSEGTPSPKIEVMGNSVSRKLIEMLLDIEHRLASNQSMNALLRDES
EMKNSRQRAVNYLIGWTNMLHPLPEVPLADKVLLLKKFSSAFTLLGTLQRSMALPHFVLPNDQVLSISASHPPELFEALT
RIIDELLTPLRRLRTDHAEFSCLKALLLLNPDVVGISNNTRERIREARDALLKTLFAYMSNTQNSIDASLRVSSLLMIIP
SLISVSSSIMEFPALSDLFGLGDVIKRDTISPKIETPPLEMKPMMPKIAQPPVTSAPTVPTNIMMNKDLISQIMNNPQLF
PLLPMPQTASPPMSFMGQSYNRNSDVIFSQCPSK
Estimated Isoelectric Point:
8.88
Estimated Molecular Weight:
48.5 kD
Amino Acid Composition:
Amino Acid Frequency
Ser47
Phe17
Thr21
Asn27
Lys23
Tyr6
Glu20
Val19
Gln16
Met20
Cys11
Leu49
Ala26
Trp2
Pro30
His7
Asp22
Arg28
Ile27
Gly16