Sequence:
download
WP:CE41244sequence.fasta
>OCT-1, isoform a MSFQAMETFAEISQEILMSATKPPDFDFVLEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPHTCHIPEGKE YLRPLTNDTQILSCKQYNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTS FYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRI FSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNV DVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVEL PGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPWLVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMG MSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGAPLPMTIEDAENFGKKPEPDSGMFTQAAKK RESQPLLEPHTPMDRRRRSSRLMNI
view sequence (585 aa)
>OCT-1, isoform a
MSFQAMETFAEISQEILMSATKPPDFDFVLEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPHTCHIPEGKE
YLRPLTNDTQILSCKQYNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTS
FYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRI
FSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNV
DVDELVDSMKNHQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVEL
PGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGYPWLVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMG
MSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGAPLPMTIEDAENFGKKPEPDSGMFTQAAKK
RESQPLLEPHTPMDRRRRSSRLMNI
Estimated Isoelectric Point:
7.81
Estimated Molecular Weight:
65.4 kD
Amino Acid Composition:
Amino Acid Frequency
Ser42
Phe49
Thr33
Asn26
Lys24
Tyr19
Glu24
Val40
Gln17
Met23
Cys12
Leu53
Ala43
Trp10
Pro33
His6
Asp22
Arg24
Ile45
Gly40