Sequence:
download
WP:CE24023sequence.fasta
>PEN-2 MDISKLTDVKKVDLCKKYFLIGACFLPLVWIVNTFWFFSDAFCKPINAHRRQIRKYVIASIVGSIFWIIVLSAWEIFFQH YRAQGLVWTDFLTFVFPTGRV
view sequence (101 aa)
>PEN-2
MDISKLTDVKKVDLCKKYFLIGACFLPLVWIVNTFWFFSDAFCKPINAHRRQIRKYVIASIVGSIFWIIVLSAWEIFFQH
YRAQGLVWTDFLTFVFPTGRV
Estimated Isoelectric Point:
9.95
Estimated Molecular Weight:
11.9 kD
Amino Acid Composition:
Amino Acid Frequency
Ser5
Phe12
Thr5
Asn2
Lys7
Tyr3
Glu1
Val10
Gln3
Met1
Cys3
Leu8
Ala6
Trp5
Pro3
His2
Asp5
Arg5
Ile11
Gly4