General
People
Want to know more about worm research?
Start here to access information about the species and data available at WormBase [Read more]
Latest updates
Need help?
Get Started
General Search
By Sequence
By Object
By Literature
Data Mining and Batch Queries
For Parasites
For Developers
Top 3 most used tools
Need help?
Get Started
Tools
Commonly requested data
Need help?
External links
We've created different user guides for distinct interests and experience levels [Read more]
Still have questions?
Please use our most recent publication to cite WormBase. Your citation is critical for ensuring the continued development of WormBase! [Read more]
expand all nodes | collapse all nodes | view schema
| WBAntibody00001961 | Summary | Rabbit polyclonal peptide antibody against DPY-27. | ||
|---|---|---|---|---|
| Public_name | [WBPaper00032450]::anti-DPY-27 | |||
| Gene | WBGene00001086 | |||
| Isolation | Original_publication | WBPaper00032450 | ||
| Location | KIR | |||
| Clonality | Polyclonal | |||
| Antigen | Peptide | QPFKRRALTSDDDRPYADTDSMPEVDLDVDRRR | ||
| Animal | Rabbit | |||
| Expr_pattern | Expr8708 | |||
| Reference (10) |
