WormBase Tree Display for Variation: WBVar00088240
expand all nodes | collapse all nodes | view schema
WBVar00088240 | Evidence | Paper_evidence | WBPaper00003607 | ||||||
---|---|---|---|---|---|---|---|---|---|
Name | Public_name | km2 | |||||||
Other_name (4) | |||||||||
HGVSg | CHROMOSOME_X:g.5369980_5370949del | ||||||||
Sequence_details | SMap | S_parent | Sequence | F35C8 | |||||
Flanking_sequences | ggaagcggctcttgtggtgtagtcgaatct | gctcctgaaagattaactatcgaggtatga | |||||||
Mapping_target | F35C8 | ||||||||
Type_of_mutation | Deletion | ||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Strain | WBStrain00024034 | ||||||||
Laboratory | KU | ||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00002177 | |||||||
WBGene00018038 | |||||||||
Transcript | F35C8.3.2 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,stop_lost,inframe_deletion,intron_variant | ||||||
VEP_impact | HIGH | ||||||||
HGVSc | F35C8.3.2:c.415_861del | ||||||||
HGVSp | CE24941:p.Ala139_Ter287delextTer? | ||||||||
cDNA_position | 612-1058 | ||||||||
CDS_position | 415-861 | ||||||||
Protein_position | 139-287 | ||||||||
Intron_number | 6-8/16 | ||||||||
Exon_number | 6-9/17 | ||||||||
Codon_change | GCGACGGTTCGCTCAAAATTGATGGCTGTGAAGGTGAGCATTACCCCTCACACGGAGGCAGTGATGTATGGTTGAGATACACATCCGGACCACTTTGAATAGAATAAATCTTGCATGGCTCCAGTATGAACTCTTGAAAAAAGATTGACAGAATCGTTGCATACGCAATTCAAAAGAGAAGGGGTCCTTCACGGGTTATCATGCGGGGGCGAAAAATTGTAGTGGTGCTAAAGACCATTAGAAATTCCATTGTTTTCGTTTTTCTTGATTCAATTGTCAATGCAAAGCAAATGCGTTAGAGAGGAGGAGAGACCTCTAAAATTGGTGGAAAACAAATTTCAGTAAAAATTCTGAACCTCTTTCAATGTGAGAACAGTAGTTTGATAAATGCGACTCTAGAGAATACGTTGACACAGAATCATAACGGTTCCCTCAGCTTTGTCTTCTTCAGACTATGTACAAAAATGACAATAAGGAAAATTTGAAACGAATTCTTCGTGACGTCCGAATTATGTCAATGTGCAATTCTCCGTTCATTGTCACCAGTTACGGATATTTCATGTTTGATGTAAGTGTGACATTCTTATTAACATATCCAATTCCTCCATTTCCAGTCGTCTGTAAAAATTTGTATGCAAATCATGTCAGCGTGTTGTGAGAAGCTGCTGCGTCGCATTTATCATTCAAAATTGGATTTTTTCCCCGAGTTTGTGGCCGGTCACATCGTCTACTCGGCGATTAGTGCACTGGATTATCTCAAGGAAAAACATGTAAGAGATTAAAGAGAAACTGCTGTGCACAAACTAAACAACTAATTCCGGATTTTCAGTCGATTATACATCGCGATATAAAACCCTCGAATATCCTTTTTGATGACAGCGGCAATGTAAAGCTGTGTGATTTTGGGATAAGTGGATTTATGACTGATTCGATGGCTCATTCCAAAAGTGCAGGATGTCCGCCATATATG/- | ||||||||
Amino_acid_change | ATVRSKLMAVKVSITPHTEAVMYG*DTHPDHFE*NKSCMAPV*TLEKRLTESLHTQFKREGVLHGLSCGGEKL*WC*RPLEIPLFSFFLIQLSMQSKCVREEERPLKLVENKFQ*KF*TSFNVRTVV**MRL*RIR*HRIITVPSALSSSDYVQK*Q*GKFETNSS*RPNYVNVQFSVHCHQLRIFHV*CKCDILINISNSSISSRL*KFVCKSCQRVVRSCCVAFIIQNWIFSPSLWPVTSSTRRLVHWIISRKNM*EIKEKLLCTN*TTNSGFSVDYTSRYKTLEYPF**QRQCKAV*FWDKWIYD*FDGSFQKCRMSAIYX/- | ||||||||
F35C8.8a.1 | VEP_consequence | intron_variant | |||||||
VEP_impact | MODIFIER | ||||||||
HGVSc | F35C8.8a.1:c.250+1220_251-645del | ||||||||
Intron_number | 3/3 | ||||||||
F35C8.3.1 (11) | |||||||||
Interactor | WBInteraction000001424 | ||||||||
WBInteraction000518749 | |||||||||
WBInteraction000520420 | |||||||||
WBInteraction000520422 | |||||||||
WBInteraction000521320 | |||||||||
WBInteraction000534884 | |||||||||
Genetics | Interpolated_map_position | X | -5.40935 | ||||||
Mapping_data | In_multi_point | 4449 | |||||||
Description | Phenotype | WBPhenotype:0000386 | Paper_evidence | WBPaper00033433 | |||||
WBPaper00035318 | |||||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Copper-induced germ cell apoptosis was abolished in jkk-1(km2) mutants (Figure 5A). | Paper_evidence | WBPaper00033433 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Cobalt did not induce increased germ cell apoptosis in jkk-1(km2) mutants, as opposed to wild type animals (Table 1) | Paper_evidence | WBPaper00035318 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Affected_by | Molecule | WBMol:00002862 | Paper_evidence | WBPaper00033433 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBMol:00003058 | Paper_evidence | WBPaper00035318 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | Worms were exposed to 10 micromolar of copper for 12 hours | Paper_evidence | WBPaper00033433 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Synchronized young adult hermaphrodites were treated in K-medium with 0.01 millimolar Cobalt chloride for 12 hours, and apoptotic cells were scored after AO staining. | Paper_evidence | WBPaper00035318 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000643 | Paper_evidence | WBPaper00032209 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_assay | Treatment | Well-fed young adults were spotted in the center of normal plates and then killed by chloroform at 4 min after spotting. The percentage of worms located outside of the 2 cm circle was recorded. | Paper_evidence | WBPaper00032209 | |||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0001171 | Paper_evidence | WBPaper00025132 | |||||||
WBPaper00032241 | |||||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | mutants show a statistically significant decrease in lifespan | Paper_evidence | WBPaper00025132 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
The jkk-1(km2)-null mutants have a short life span compared with wild type. | Paper_evidence | WBPaper00032241 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0001351 | Paper_evidence | WBPaper00025132 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Phosphorylated JNK-1 is not detectable. | Paper_evidence | WBPaper00025132 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0001785 | Paper_evidence | WBPaper00046360 | |||||||
Curator_confirmed | WBPerson3142 | ||||||||
Phenotype_not_observed | WBPhenotype:0000104 | Paper_evidence | WBPaper00027345 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | jkk-1(km2) mutant males do not exhibit a B cell polarity defect | Paper_evidence | WBPaper00027345 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0001715 | PATO:0000460 | Paper_evidence | WBPaper00027345 | ||||
Curator_confirmed | WBPerson2987 | ||||||||
WBbt:0001750 | PATO:0000460 | Paper_evidence | WBPaper00027345 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000142 | Paper_evidence | WBPaper00031666 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Upregulation of pnlp-29::GFP after infection with D. coniospora was unaltered from that of wild type. | Paper_evidence | WBPaper00031666 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Phenotype_assay | Treatment | Animals were infected with D. coniospora at the L4 stage and maintained on OP50 at 20C. | Paper_evidence | WBPaper00031666 | |||||
Curator_confirmed | WBPerson712 | ||||||||
Genotype | frIs7 | Paper_evidence | WBPaper00031666 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000315 | Paper_evidence | WBPaper00004889 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Abnormalities in touch responses were not detected in jkk-1(km2) mutant animals | Paper_evidence | WBPaper00004889 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000460 | Paper_evidence | WBPaper00032241 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | jkk-1(km2) exhibited normal sensitivity to paraquat. | Paper_evidence | WBPaper00032241 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000593 | Paper_evidence | WBPaper00004889 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Figure 8A | Paper_evidence | WBPaper00004889 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Affected_by | Molecule | WBMol:00002862 | Paper_evidence | WBPaper00004889 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | Four worms were allowed to lay eggs in normal NGMSR plates containing the indicated concentrations of heavy metals. After 6 h, worms were removed, and the number of eggs counted. The percentage (+/- standard errors) of worms reaching adulthood 4 days after egg laying is compiled from three experiments. | Paper_evidence | WBPaper00004889 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0000640 | Paper_evidence | WBPaper00004889 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
WBPhenotype:0001173 | Paper_evidence | WBPaper00040855 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
Remark | Adult males show appropriate cell death of the linker cell. | Paper_evidence | WBPaper00040855 | ||||||
Curator_confirmed | WBPerson557 | ||||||||
WBPhenotype:0001655 | Paper_evidence | WBPaper00004889 | |||||||
Curator_confirmed | WBPerson2987 | ||||||||
Remark | Figure 8B | Paper_evidence | WBPaper00004889 | ||||||
Curator_confirmed | WBPerson2987 | ||||||||
Affected_by | Molecule | WBMol:00003022 | Paper_evidence | WBPaper00004889 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Phenotype_assay | Treatment | Four worms were allowed to lay eggs in normal NGMSR plates containing the indicated concentrations of heavy metals. After 6 h, worms were removed, and the number of eggs counted. The percentage (+/- standard errors) of worms reaching adulthood 4 days after egg laying is compiled from three experiments. | Paper_evidence | WBPaper00004889 | |||||
Curator_confirmed | WBPerson2987 | ||||||||
Reference (16) | |||||||||
Method | Deletion_allele |