WormBase Tree Display for Variation: WBVar00241898

WBVar00241898 Evidence: Paper_evidence: WBPaper00031432
  Name: Public_name: s939
    Other_name: Y39A1B.3.1:c.3086_3283del
      CE31734:p.Ile1029_Pro1095delinsThr
    HGVSg: CHROMOSOME_III:g.10771155_10771352del
  Sequence_details: SMap: S_parent: Sequence: Y39A1B
    Flanking_sequences: gtagagtaatggaaaaattaatggcattta caggtgccacatccaatgatctacaccatc
    Mapping_target: Y39A1B
    Type_of_mutation: Deletion
    SeqStatus: Sequenced
  Variation_type: Allele
  Origin: Species: Caenorhabditis elegans
    Strain: WBStrain00035091
      WBStrain00035155
    Laboratory: BC
    Status: Live
  Affects: Gene: WBGene00001087
    Transcript: Y39A1B.3.1 VEP_consequence: inframe_deletion
        VEP_impact: MODERATE
        HGVSc: Y39A1B.3.1:c.3086_3283del
        HGVSp: CE31734:p.Ile1029_Pro1095delinsThr
        cDNA_position: 3102-3299
        CDS_position: 3086-3283
        Protein_position: 1029-1095
        Exon_number: 11/18
        Codon_change: aTTGGTGAAGTGGCTGTTCAGTTGAATGCTTATATTCAAGTAACAATCCCAAAACTTCATACAAGATATGTATCGAAAATGGTTGACGCCGAGAAAAACGATGCGAATATTCGTGAAGAACCCGTCAGATTCCTAAGTGATCTTGAGAAATCGGTTGCTCAACGGAAAACAATATTCACAGTACCACAAGACACTACACca/aca
        Amino_acid_change: IGEVAVQLNAYIQVTIPKLHTRYVSKMVDAEKNDANIREEPVRFLSDLEKSVAQRKTIFTVPQDTTP/T
    Interactor: WBInteraction000052338
      WBInteraction000501498
      WBInteraction000501666
      WBInteraction000505164
      WBInteraction000541633
  Genetics: Interpolated_map_position: III 5.36454
    Mapping_data: In_multi_point: 1357
  Description: Phenotype: WBPhenotype:0000066 Paper_evidence: WBPaper00001011
        Curator_confirmed: WBPerson712
        Maternal: With_maternal_effect: Paper_evidence: WBPaper00001011
            Curator_confirmed: WBPerson712
      WBPhenotype:0000583 Paper_evidence: WBPaper00001011
        Curator_confirmed: WBPerson712
      WBPhenotype:0000718 Paper_evidence: WBPaper00001011
        Curator_confirmed: WBPerson712
        Remark: As determined by the penetrance of the lin-14(n179) mutant phenotype, based on the # mutant seam cell nuclei (undivided seam cell nuclei + nuclei that generated precocious alae)/ total # seam cell nuclei animals after the L3 molt. Paper_evidence: WBPaper00001011
            Curator_confirmed: WBPerson712
        Phenotype_assay: Treatment: Nomarski optics were used to follow the fates of the midbody seam cell nuclei of L3 animals raised at 24C. Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
          Temperature: 24 Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
      WBPhenotype:0001403 Paper_evidence: WBPaper00032450
        Curator_confirmed: WBPerson712
        Remark: CAPG-1 localizes to X chromosomes in wild-type hermphrodites, but not in animals carrying mutated subunits of condensin IDC. Paper_evidence: WBPaper00032450
            Curator_confirmed: WBPerson712
      WBPhenotype:0001581 Paper_evidence: WBPaper00001011
        Curator_confirmed: WBPerson712
        Remark: Animals have 39%(n=20) mutant seam cell nuclei, similar to XXX lin-14 animals (26% n=25) and less mutant than XX lin-14 animals (77% n=40). Paper_evidence: WBPaper00001011
            Curator_confirmed: WBPerson712
        EQ_annotations: Anatomy_term: WBbt:0006913 PATO:0000460 Paper_evidence: WBPaper00001011
                Curator_confirmed: WBPerson712
          Life_stage: WBls:0000035 PATO:0000460 Paper_evidence: WBPaper00001011
                Curator_confirmed: WBPerson712
        Phenotype_assay: Treatment: Nomarski optics were used to follow the fates of the midbody seam cell nuclei of L3 animals raised at 24C. Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
          Temperature: 24 Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
      WBPhenotype:0001631 Paper_evidence: WBPaper00001011
        Curator_confirmed: WBPerson712
        Remark: Animals produce a very small number of nullo-X oocytes (0.5%). Paper_evidence: WBPaper00001011
            Curator_confirmed: WBPerson712
        Penetrance: Low: Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
      WBPhenotype:0002408 Paper_evidence: WBPaper00042416
        Curator_confirmed: WBPerson3249
        EQ_annotations: GO_term: GO:0000910 PATO:0000460 Paper_evidence: WBPaper00042416
                Curator_confirmed: WBPerson3249
    Phenotype_not_observed: WBPhenotype:0000928 Paper_evidence: WBPaper00001011
        Curator_confirmed: WBPerson712
        Remark: Percent of lin-14 mutant seam cell nuclei in XO males is not different to that of males carrying lin-14 alone. Paper_evidence: WBPaper00001011
            Curator_confirmed: WBPerson712
        EQ_annotations: Life_stage: WBls:0000056 PATO:0000460 Paper_evidence: WBPaper00001011
                Curator_confirmed: WBPerson712
        Phenotype_assay: Treatment: All animals were raised at 20C. Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
          Temperature: 20 Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
          Genotype: unc-32/+; lin-14(n179)/0 Paper_evidence: WBPaper00001011
              Curator_confirmed: WBPerson712
  Reference: WBPaper00016555
    WBPaper00001011
    WBPaper00013715
    WBPaper00017475
    WBPaper00032450
    WBPaper00042416
    WBPaper00064961
  Remark: The location of s939 was sent by personal communication from B. Meyer and is a correction of data published in Tsai et al. PMID 18198337 Curator_confirmed: WBPerson2970
  Method: Deletion_allele