WormBase Tree Display for Variation: WBVar00266623
expand all nodes | collapse all nodes | view schema
WBVar00266623 | Evidence | Paper_evidence | WBPaper00003969 | |||||
---|---|---|---|---|---|---|---|---|
WBPaper00024641 | ||||||||
Name | Public_name | u253 | ||||||
Other_name | CE39109:p.Thr148_Asp268del | |||||||
T01C8.7.1:c.440_802del | ||||||||
HGVSg | CHROMOSOME_X:g.16805906_16806268del | |||||||
Sequence_details | SMap | S_parent | Sequence | F41G4 | ||||
Flanking_sequences | gtgctccttactgagcttttttatttccag | gtgagtgttgcatgtcaaatgagcatcgcg | ||||||
Mapping_target | F41G4 | |||||||
Type_of_mutation | Deletion | |||||||
SeqStatus | Sequenced | |||||||
Variation_type | Allele | |||||||
Origin | Species | Caenorhabditis elegans | ||||||
Strain | WBStrain00035037 | |||||||
Laboratory | TU | |||||||
Status | Live | |||||||
Affects | Gene | WBGene00003168 | ||||||
Transcript | T01C8.7.1 | VEP_consequence | inframe_deletion,splice_region_variant | |||||
VEP_impact | MODERATE | |||||||
HGVSc | T01C8.7.1:c.440_802del | |||||||
HGVSp | CE39109:p.Thr148_Asp268del | |||||||
cDNA_position | 441-803 | |||||||
CDS_position | 440-802 | |||||||
Protein_position | 147-268 | |||||||
Exon_number | 4/17 | |||||||
Codon_change | gACACTGCACCTTTTCCAGCAATTACGCTTTGTAATTTGAATCCTTACAAAGCAAGTTTAGCAACAAGCGTGGATTTAGTAAAGCGAACGTTGTCAGCATTTGATGGAGCAATGGGAAAAGCCGGAGGAAACAAAGATCACGAAGAGGAACGCGAAGTTGTCACCGAACCACCCACCACCCCTGCACCCACCACAAAACCGGCACGTCGTCGAGGAAAACGTGATTTATCTGGAGCATTTTTTGAGCCAGGATTTGCAAGATGCCTTTGTGGAAGCCAAGGGTCTAGTGAGCAAGAGGATAAGGATGAGGAGAAGGAGGAAGAGTTACTTGAAACAACTACCAAAAAGGTATTTAATATTAATGat/gat | |||||||
Amino_acid_change | DTAPFPAITLCNLNPYKASLATSVDLVKRTLSAFDGAMGKAGGNKDHEEEREVVTEPPTTPAPTTKPARRRGKRDLSGAFFEPGFARCLCGSQGSSEQEDKDEEKEEELLETTTKKVFNIND/D | |||||||
Isolation | Mutagen | EMS | Paper_evidence | WBPaper00003969 | ||||
Genetics | Interpolated_map_position | X | 24.0629 | |||||
Description | Phenotype | WBPhenotype:0000315 | Paper_evidence | WBPaper00053740 | ||||
Curator_confirmed | WBPerson31209 | |||||||
Remark | response to ultrasound stimulation significantly different from wild-type. | Paper_evidence | WBPaper00053740 | |||||
Curator_confirmed | WBPerson31209 | |||||||
WBPhenotype:0000646 | Paper_evidence | WBPaper00039982 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | mec-4(u253) complete loss-of-function animals are lethargic. | Paper_evidence | WBPaper00039982 | |||||
Curator_confirmed | WBPerson712 | |||||||
WBPhenotype:0001434 | Paper_evidence | WBPaper00049074 | ||||||
Curator_confirmed | WBPerson6118 | |||||||
Remark | enhanced acuity to low dilutions of AWC-sensed odors (benzaldehyde and isoamyl alcohol); reduced response to low dilution of AWA-sensed odors (diacetyl and pyrazine) | Paper_evidence | WBPaper00049074 | |||||
Curator_confirmed | WBPerson6118 | |||||||
Phenotype_assay | Control_strain | WBStrain00000001 | Paper_evidence | WBPaper00049074 | ||||
Curator_confirmed | WBPerson6118 | |||||||
WBPhenotype:0001506 | Paper_evidence | WBPaper00049074 | ||||||
Curator_confirmed | WBPerson6118 | |||||||
Remark | enhanced reversing rate off food and reduced reversing rate on food compared to N2 | Paper_evidence | WBPaper00049074 | |||||
Curator_confirmed | WBPerson6118 | |||||||
Phenotype_assay | Control_strain | WBStrain00000001 | Paper_evidence | WBPaper00049074 | ||||
Curator_confirmed | WBPerson6118 | |||||||
WBPhenotype:0004026 | Paper_evidence | WBPaper00049074 | ||||||
Curator_confirmed | WBPerson6118 | |||||||
Remark | suppressed nose touch response | Paper_evidence | WBPaper00049074 | |||||
Curator_confirmed | WBPerson6118 | |||||||
Phenotype_assay | Control_strain | WBStrain00000001 | Paper_evidence | WBPaper00049074 | ||||
Curator_confirmed | WBPerson6118 | |||||||
Phenotype_not_observed | WBPhenotype:0000397 | Paper_evidence | WBPaper00040149 | |||||
Curator_confirmed | WBPerson712 | |||||||
Remark | 85 +/-8% of mec-4(u253) responded to prodding with a platinum wire. | Paper_evidence | WBPaper00040149 | |||||
Curator_confirmed | WBPerson712 | |||||||
WBPhenotype:0004028 | Paper_evidence | WBPaper00049074 | ||||||
Curator_confirmed | WBPerson6118 | |||||||
Phenotype_assay | Control_strain | WBStrain00000001 | Paper_evidence | WBPaper00049074 | ||||
Curator_confirmed | WBPerson6118 | |||||||
Reference | WBPaper00039982 | |||||||
WBPaper00040149 | ||||||||
WBPaper00029017 | ||||||||
WBPaper00029013 | ||||||||
WBPaper00049074 | ||||||||
WBPaper00053740 | ||||||||
WBPaper00065340 | ||||||||
WBPaper00065804 | ||||||||
Remark | u253 comprises a deletion within exon 3. The left and right flanks refer to the left and right of exon 3, respectively (exact breakpoints are not detailed in the paper). | Paper_evidence | WBPaper00003969 | |||||
u253 has a deletion in exon 3. | Paper_evidence | WBPaper00024641 | ||||||
Method | Deletion_allele |