WormBase Tree Display for Variation: WBVar00603976

WBVar00603976 Name: Public_name: tm5692
    Other_name: Y54E10BR.4a.1:c.248_429del
      CE27481:p.Leu83ArgfsTer4
    HGVSg: CHROMOSOME_I:g.3018070_3018251del
  Sequence_details: SMap: S_parent: Sequence: Y54E10BR
    Flanking_sequences: catcaaagactactggagactttcaatctc gaggaaaatgaggaaagtgaagattcagct
    Mapping_target: Y54E10BR
    Source_location: 7 CHROMOSOME_I 3018069 3018252 Inferred_automatically: National_Bioresource_Project
    Type_of_mutation: Deletion
    PCR_product: tm5692_external
      tm5692_internal
    SeqStatus: Sequenced
  Variation_type: Allele
  Origin: Species: Caenorhabditis elegans
    Laboratory: FX
    Author: Mitani S
    DB_info: Database: National_Bioresource_Project seq 5692
    NBP_allele
    Status: Live
  Affects: Gene: WBGene00021843
    Transcript: Y54E10BR.4a.1 VEP_consequence: frameshift_variant
        VEP_impact: HIGH
        HGVSc: Y54E10BR.4a.1:c.248_429del
        HGVSp: CE27481:p.Leu83ArgfsTer4
        cDNA_position: 251-432
        CDS_position: 248-429
        Protein_position: 83-143
        Exon_number: 3/6
        Codon_change: cTATCAATGGTTGATATTAAAATGATTGCGTTGACTTATGATCTACATAGACAATATGTTGCTGAAAATGACGTTGCTGAGACTACAGAAGATGATGAGAAGAAGAATATTGAGGATTTAAGTGCGAAAGTTGAACAAGTTACTGTTGGAGAGAATACGGAAGATACCAAGGAAGAAGAGATC/c
        Amino_acid_change: LSMVDIKMIALTYDLHRQYVAENDVAETTEDDEKKNIEDLSAKVEQVTVGENTEDTKEEEI/X
      Y54E10BR.4b.1 VEP_consequence: coding_sequence_variant,5_prime_UTR_variant
        VEP_impact: MODIFIER
        cDNA_position: ?-177
        CDS_position: ?-177
        Protein_position: ?-59
        Exon_number: 1/3
  Isolation: Mutagen: TMP/UV
  Genetics: Map: I
  Description: Phenotype: WBPhenotype:0000062 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Classified as lethal OR sterile by the National Bioresource Project of Japan. Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
      WBPhenotype:0000688 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Classified as lethal OR sterile by the National Bioresource Project of Japan. Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
  Remark: 3153/3154-3335/3336 (182 bp deletion)
    This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. Paper_evidence: WBPaper00041807
  Method: NBP_knockout_allele