WormBase Tree Display for Variation: WBVar00250861

WBVar00250861 Name: Public_name: tm1898
    Other_name: T27C10.3.1:c.-13-1437_-13-1061delinsCGTCGTCGT
      CE41939:p.Arg441ThrfsTer5
      T27C10.6.1:c.1321_1697delinsACGACGACG
    HGVSg: CHROMOSOME_I:g.10887524_10887900delinsCGTCGTCGT
  Sequence_details: SMap: S_parent: Sequence: T27C10
    Flanking_sequences: atgtaataagttggaatttcaattttacgt aagagccttgttatcagtgtccagagctcc
    Mapping_target: T27C10
    Source_location: 7 CHROMOSOME_I 10887523 10887901 Inferred_automatically: National_Bioresource_Project
    Type_of_mutation: Insertion: CGTCGTCGT
      Deletion
    PCR_product: tm1898_external
      tm1898_internal
    SeqStatus: Sequenced
  Variation_type: Allele
  Origin: Species: Caenorhabditis elegans
    Laboratory: FX
    Author: Mitani S
    DB_info: Database: National_Bioresource_Project seq 1898
    NBP_allele
    Status: Live
  Affects: Gene: WBGene00003068
      WBGene00020858
    Transcript: T27C10.3.1 VEP_consequence: intron_variant
        VEP_impact: MODIFIER
        HGVSc: T27C10.3.1:c.-13-1437_-13-1061delinsCGTCGTCGT
        Intron_number: 1/8
      T27C10.6.1 VEP_consequence: frameshift_variant
        VEP_impact: HIGH
        HGVSc: T27C10.6.1:c.1321_1697delinsACGACGACG
        HGVSp: CE41939:p.Arg441ThrfsTer5
        cDNA_position: 1333-1709
        CDS_position: 1321-1697
        Protein_position: 441-566
        Exon_number: 11/22
        Codon_change: CGACTTGCTGCTCAGGGGAAGAACGAGAAGCTCATTCGGGTTTTTCTGGTTCGCCTGGTTTTTGCGGACCCTGAATATAAGATCAATAAGAAAAACATTGATGTAGGTCAGATTCAAGTTGGTCAGAGTCTGCTACCAAGTTCACTGTGCCCATCAAAAGCCGCCCAACTGAATTGGAATTCAGCCAATTTGGAGCAACTTCAATCGGATTGGTTTGTGGCGGCAGCTCTACACGTGAACCCGAGACTCCGAACAACGAGGTTATCACTGGCAGCAATCACTCGGGTCGATTTATCGGACAATCGTCTCAACACATTCCCAAGTATTCTATTCCAAATGCCATCGCTCAGATCTCTAAATCTAGCTGATAATAGTATa/ACGACGACGa
        Amino_acid_change: RLAAQGKNEKLIRVFLVRLVFADPEYKINKKNIDVGQIQVGQSLLPSSLCPSKAAQLNWNSANLEQLQSDWFVAAALHVNPRLRTTRLSLAAITRVDLSDNRLNTFPSILFQMPSLRSLNLADNSI/TTTX
  Isolation: Mutagen: TMP/UV
  Genetics: Map: I
  Description: Phenotype: WBPhenotype:0000306 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Comment from Dr. Y. Jin to the National Bioresource Project of Japan: very weak defect in SNB-1-gfp expression. Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
      WBPhenotype:0002069 Paper_evidence: WBPaper00049878
        Curator_confirmed: WBPerson8620
        Remark: Less than 20% of animals exhibit overextension of ALM axons. Paper_evidence: WBPaper00049878
            Curator_confirmed: WBPerson8620
        EQ_annotations: Anatomy_term: WBbt:0005406 PATO:0000460 Paper_evidence: WBPaper00049878
                Curator_confirmed: WBPerson8620
          GO_term: GO:0030424 PATO:0000460 Paper_evidence: WBPaper00049878
                Curator_confirmed: WBPerson8620
        Temperature_sensitive: Heat_sensitive: Paper_evidence: WBPaper00049878
              Curator_confirmed: WBPerson8620
    Phenotype_not_observed: WBPhenotype:0000062 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Classified as homozygous viable by the National Bioresource Project of Japan. Comment to the NBP from Dr. E. Schmidt: J. Biol. Chem. in press. Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
            Laboratory_evidence: FX
      WBPhenotype:0000625 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Comment from Dr. K. Shen to the National Bioresource Project of Japan: normal formation of presynaptic sites in DA9 as determined by VAMP and RAB-3 localization. Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
      WBPhenotype:0000847 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Comment from Dr. K. Shen to the National Bioresource Project of Japan: normal formation of presynaptic sites in DA9 as determined by VAMP and RAB-3 localization. Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
      WBPhenotype:0001462 Person_evidence: WBPerson7743
        Curator_confirmed: WBPerson712
        Remark: Comment from Dr. H. Suzuki to the National Bioresource Project of Japan: normal chemotaxis to NaCl Person_evidence: WBPerson7743
            Curator_confirmed: WBPerson712
  Reference: WBPaper00049878
  Remark: 13741/13742-CGTCGTCGT-14118/14119 (377 bp deletion + 9 bp insertion)
    This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. Paper_evidence: WBPaper00041807
  Method: NBP_knockout_allele