WormBase Tree Display for Variation: WBVar00251609
expand all nodes | collapse all nodes | view schema
WBVar00251609 | Name | Public_name | tm2769 | |||||
---|---|---|---|---|---|---|---|---|
Other_name (7) | ||||||||
HGVSg | CHROMOSOME_V:g.10237539_10237762del | |||||||
Sequence_details | SMap | S_parent | Sequence | C12D8 | ||||
Flanking_sequences | cattaccatcacctccactgttaagaattt | gtgggattgcaatgtcaatagtggtttggg | ||||||
Mapping_target | C12D8 | |||||||
Source_location | 7 | CHROMOSOME_V | 10237538 | 10237764 | Inferred_automatically | National_Bioresource_Project | ||
Type_of_mutation | Insertion | G | ||||||
Deletion | ||||||||
PCR_product | tm2769_external | |||||||
tm2769_internal | ||||||||
SeqStatus | Sequenced | |||||||
Variation_type | Allele | |||||||
Origin | Species | Caenorhabditis elegans | ||||||
Laboratory | FX | |||||||
Author | Mitani S | |||||||
DB_info | Database | National_Bioresource_Project | seq | 2769 | ||||
NBP_allele | ||||||||
Status | Live | |||||||
Affects | Gene | WBGene00007534 | ||||||
Transcript | C12D8.1b.2 (11) | |||||||
C12D8.1a.1 (11) | ||||||||
C12D8.1c.1 (11) | ||||||||
C12D8.1b.1 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,frameshift_variant,intron_variant | ||||||
VEP_impact | HIGH | |||||||
HGVSc | C12D8.1b.1:c.489_664del | |||||||
HGVSp | CE05267:p.Arg165SerfsTer2 | |||||||
cDNA_position | 1104-1280 | |||||||
CDS_position | 488-664 | |||||||
Protein_position | 163-222 | |||||||
Intron_number | 2/5 | |||||||
Exon_number | 2-3/6 | |||||||
Codon_change | cCAAACCGTTGTGGTCTGATCATTGGAAAGTCTGGTGATACCATTAGACAGCTTCAGGTTGGTTTTCAAAATGTATTATGTCAAAAAAAAAGTTGTATTTTTCAGGAGAAAAGTGGTTGTAAAATGATCCTTGTACAAGACAATCAATCCGTTAGCGACCAGTCCAAGCCTTTACGTATTACCGGTGATCCACAAAAGATTGAACTTGCAAAACAGTTAGTTGCCGaa/cCaa | |||||||
Amino_acid_change | PNRCGLIIGKSGDTIRQLQVGFQNVLCQKKSCIFQEKSGCKMILVQDNQSVSDQSKPLRITGDPQKIELAKQLVAE/PX | |||||||
Isolation | Mutagen | TMP/UV | ||||||
Genetics | Map | V | ||||||
Description | Phenotype_not_observed | WBPhenotype:0000048 | Person_evidence | WBPerson7743 | ||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Comment to the National Bioresource Project of Japan from Dr. K.F. O'Connell: normal hatching. | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
Laboratory_evidence | FX | |||||||
WBPhenotype:0000062 | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Classified as homozygous viable by the National Bioresource Project of Japan. | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
Laboratory_evidence | FX | |||||||
WBPhenotype:0000072 | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Comment to the National Bioresource Project of Japan from Dr. K.F. O'Connell: normal body shape. | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
Laboratory_evidence | FX | |||||||
WBPhenotype:0000643 | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Comment to the National Bioresource Project of Japan from Dr. K.F. O'Connell: normal locomotion. | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
Laboratory_evidence | FX | |||||||
Remark | 19372/19373-G-19597/19598 (225 bp deletion + 1 bp insertion) | |||||||
This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. | Paper_evidence | WBPaper00041807 | ||||||
Method | NBP_knockout_allele |