WormBase Tree Display for Variation: WBVar00251643
expand all nodes | collapse all nodes | view schema
WBVar00251643 | Name | Public_name | tm2815 | ||||||
---|---|---|---|---|---|---|---|---|---|
Other_name | R06C7.8.1:c.1413_1727del | ||||||||
CE06251:p.Glu472_Ter576delextTer? | |||||||||
HGVSg | CHROMOSOME_I:g.7253447_7253850del | ||||||||
Sequence_details | SMap | S_parent | Sequence | R06C7 | |||||
Flanking_sequences | tgggttgaatgttgtttacgatgaggcagc | aaatcaagccgttcagccctcagtcacaga | |||||||
Mapping_target | R06C7 | ||||||||
Source_location | 7 | CHROMOSOME_I | 7253446 | 7253851 | Inferred_automatically | National_Bioresource_Project | |||
Type_of_mutation | Deletion | ||||||||
PCR_product | tm2815_external | ||||||||
tm2815_internal | |||||||||
SeqStatus | Sequenced | ||||||||
Variation_type | Allele | ||||||||
Origin | Species | Caenorhabditis elegans | |||||||
Laboratory | FX | ||||||||
Author | Mitani S | ||||||||
DB_info | Database | National_Bioresource_Project | seq | 2815 | |||||
NBP_allele | |||||||||
Status | Live | ||||||||
Affects | Gene | WBGene00000275 | |||||||
Transcript | R06C7.8.1 | VEP_consequence | splice_acceptor_variant,splice_donor_variant,stop_lost,inframe_deletion,intron_variant | ||||||
VEP_impact | HIGH | ||||||||
HGVSc | R06C7.8.1:c.1413_1727del | ||||||||
HGVSp | CE06251:p.Glu472_Ter576delextTer? | ||||||||
cDNA_position | 1419-1733 | ||||||||
CDS_position | 1413-1727 | ||||||||
Protein_position | 471-576 | ||||||||
Intron_number | 4-5/7 | ||||||||
Exon_number | 4-6/8 | ||||||||
Codon_change | gcCGAACCGGAAGAATCTCAGAAAGTTGAGGAATCTGAAGTACAACCCGAAATTGTCCTAGTTTCTCCAGTGACGCAAACCTCACCAGCTACAATGTTTAATGATAGTGGGTTTATCGAAAAATATAACAACTTATGTTTTAATTTTTAGTTTATGACGATGAAATCGAGTTTGGCTTTTTCAAACCGTCTCGTGGTAATTTCGTCACATCGACCCCCGCACAAGGAGTTCATTTGGTCAACATTGATGAATATTTCGGAAATAAAGAGGAGGAAAGCACTCACGAACAGGAAGCTCCAGTATTTGTTGCTCCAACCAGCAGTACTTTCAGTAAATTAGTAAGTGCCAGACAAATTTTCGACATACTATTCAAACTTTTTCAGACACGTCGAAAGTCACTAGCAGCa/gca | ||||||||
Amino_acid_change | AEPEESQKVEESEVQPEIVLVSPVTQTSPATMFNDSGFIEKYNNLCFNF*FMTMKSSLAFSNRLVVISSHRPPHKEFIWSTLMNISEIKRRKALTNRKLQYLLLQPAVLSVN**VPDKFSTYYSNFFRHVESH*QX/A | ||||||||
Isolation | Mutagen | TMP/UV | |||||||
Genetics | Map | I | |||||||
Description | Phenotype | WBPhenotype:0000016 | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Comment to the NBP from Dr. L. Dreier: paralyzes faster in the presence of aldicarb. | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Laboratory_evidence | IY | ||||||||
Affected_by | Molecule | WBMol:00003650 | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | ||||||||
EQ_annotations | Anatomy_term | WBbt:0007833 | PATO:0001549 | Person_evidence | WBPerson7743 | ||||
Curator_confirmed | WBPerson712 | ||||||||
WBPhenotype:0000059 | Paper_evidence | WBPaper00033465 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
WBPhenotype:0000062 | Person_evidence | WBPerson7743 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Classified as lethal OR sterile by the National Bioresource Project of Japan. | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Laboratory_evidence | FX | ||||||||
WBPhenotype:0000180 | Paper_evidence | WBPaper00033465 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
Remark | Authors note longitudinal extension defects in axons that were scored as regions that lack GFP-labeled axons. | Paper_evidence | WBPaper00033465 | ||||||
Curator_confirmed | WBPerson557 | ||||||||
Phenotype_assay | Genotype | Punc-25::GFP | Paper_evidence | WBPaper00033465 | |||||
Curator_confirmed | WBPerson557 | ||||||||
WBPhenotype:0000384 | Paper_evidence | WBPaper00033465 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
Remark | Axon guidance defects include premature stop or inappropriate branching of axons. | Paper_evidence | WBPaper00033465 | ||||||
Curator_confirmed | WBPerson557 | ||||||||
Phenotype_assay | Genotype | Punc-25::GFP | Paper_evidence | WBPaper00033465 | |||||
Curator_confirmed | WBPerson557 | ||||||||
WBPhenotype:0000643 | Person_evidence | WBPerson7743 | |||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Comment to the NBP from Dr. L. Dreier: Unc, paralyzes faster in the presence of aldicarb. | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Laboratory_evidence | IY | ||||||||
WBPhenotype:0000679 | Paper_evidence | WBPaper00033465 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
Remark | Authors note longitudinal extension defects in axons that were scored as regions that lack GFP-labeled axons. | Paper_evidence | WBPaper00033465 | ||||||
Curator_confirmed | WBPerson557 | ||||||||
Phenotype_assay | Genotype | Punc-25::GFP | Paper_evidence | WBPaper00033465 | |||||
Curator_confirmed | WBPerson557 | ||||||||
WBPhenotype:0000688 | Paper_evidence | WBPaper00033465 | |||||||
Person_evidence | WBPerson7743 | ||||||||
Curator_confirmed | WBPerson712 | ||||||||
WBPerson557 | |||||||||
Remark | Classified as lethal OR sterile by the National Bioresource Project of Japan. Comment to the NBP from Dr. L. Dreier: Ste. | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Laboratory_evidence | FX | ||||||||
IY | |||||||||
WBPhenotype:0000697 | Paper_evidence | WBPaper00033465 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
Penetrance | Low | Paper_evidence | WBPaper00033465 | ||||||
Curator_confirmed | WBPerson557 | ||||||||
WBPhenotype:0000698 | Paper_evidence | WBPaper00033465 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
WBPhenotype:0001226 | Paper_evidence | WBPaper00033465 | |||||||
Curator_confirmed | WBPerson557 | ||||||||
Remark | Commissure defect refers to the D-type neuron commissures that extend from left side of the animals. | Paper_evidence | WBPaper00033465 | ||||||
Curator_confirmed | WBPerson557 | ||||||||
Phenotype_assay | Genotype | Punc-25::GFP | Paper_evidence | WBPaper00033465 | |||||
Curator_confirmed | WBPerson557 | ||||||||
Phenotype_not_observed | WBPhenotype:0001225 | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Remark | Comment to the NBP from Dr. H. Sawa: non Psa. | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | ||||||||
Laboratory_evidence | HS | ||||||||
Reference | WBPaper00033465 | ||||||||
Remark | 21101/21102-21505/21506 (404 bp deletion) | ||||||||
This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. | Paper_evidence | WBPaper00041807 | |||||||
Method | NBP_knockout_allele |