WormBase Tree Display for Variation: WBVar00251773
expand all nodes | collapse all nodes | view schema
WBVar00251773 | Name | Public_name | tm2979 | |||||
---|---|---|---|---|---|---|---|---|
Other_name | CE36619:p.Tyr52_Asn106del | |||||||
Y39B6A.2a.1:c.154_318del | ||||||||
HGVSg | CHROMOSOME_V:g.19190766_19190930del | |||||||
Sequence_details | SMap | S_parent | Sequence | Y39B6A | ||||
Flanking_sequences | gatcaagtgtacgacgtggccgccgacctc | atggctctggggcggtttaaaaaggcgttg | ||||||
Mapping_target | Y39B6A | |||||||
Source_location | 7 | CHROMOSOME_V | 19190765 | 19190931 | Inferred_automatically | National_Bioresource_Project | ||
Type_of_mutation | Deletion | |||||||
PCR_product | tm2979_external | |||||||
tm2979_internal | ||||||||
SeqStatus | Sequenced | |||||||
Variation_type | Allele | |||||||
Origin | Species | Caenorhabditis elegans | ||||||
Laboratory | FX | |||||||
Author | Mitani S | |||||||
DB_info | Database | National_Bioresource_Project | seq | 2979 | ||||
NBP_allele | ||||||||
Status | Live | |||||||
Affects | Gene | WBGene00012665 | ||||||
Transcript | Y39B6A.2a.1 | VEP_consequence | inframe_deletion | |||||
VEP_impact | MODERATE | |||||||
HGVSc | Y39B6A.2a.1:c.154_318del | |||||||
HGVSp | CE36619:p.Tyr52_Asn106del | |||||||
cDNA_position | 162-326 | |||||||
CDS_position | 154-318 | |||||||
Protein_position | 52-106 | |||||||
Exon_number | 3/10 | |||||||
Codon_change | TACTCTGTCGCAATTGAGATTCATCCGACGGCGGTTCTTTACGGAAACCGTGCACAGGCCTATCTGAAGAAAGAGCTCTACGGAAGTGCTCTTGAGGATGCGGACAACGCGATTGCAATTGATCCGTCATATGTGAAGGGATTCTATAGAAGAGCTACCGCCAAT/- | |||||||
Amino_acid_change | YSVAIEIHPTAVLYGNRAQAYLKKELYGSALEDADNAIAIDPSYVKGFYRRATAN/- | |||||||
Interactor | WBInteraction000500816 | |||||||
WBInteraction000500817 | ||||||||
Isolation | Mutagen | TMP/UV | ||||||
Genetics | Map | V | ||||||
Description | Phenotype_not_observed | WBPhenotype:0000050 | Paper_evidence | WBPaper00040142 | ||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Animals are healthy at all temperatures. | Paper_evidence | WBPaper00040142 | |||||
Curator_confirmed | WBPerson712 | |||||||
Phenotype_assay | Temperature | 24 | Paper_evidence | WBPaper00040142 | ||||
Curator_confirmed | WBPerson712 | |||||||
WBPhenotype:0000062 | Person_evidence | WBPerson7743 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Classified as 'homozygous viable' by the National Bioresource Project of Japan. | Person_evidence | WBPerson7743 | |||||
Curator_confirmed | WBPerson712 | |||||||
WBPhenotype:0000112 | Paper_evidence | WBPaper00040142 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | PPH-5 protein could be detected. | Paper_evidence | WBPaper00040142 | |||||
Curator_confirmed | WBPerson712 | |||||||
Phenotype_assay | Temperature | 24 | Paper_evidence | WBPaper00040142 | ||||
Curator_confirmed | WBPerson712 | |||||||
WBPhenotype:0000688 | Paper_evidence | WBPaper00040142 | ||||||
Curator_confirmed | WBPerson712 | |||||||
Remark | Animals are fertile at all temperatures. | Paper_evidence | WBPaper00040142 | |||||
Curator_confirmed | WBPerson712 | |||||||
Phenotype_assay | Temperature | 24 | Paper_evidence | WBPaper00040142 | ||||
Curator_confirmed | WBPerson712 | |||||||
Reference | WBPaper00040142 | |||||||
Remark | 232709/232710-232874/232875 (165 bp deletion) | |||||||
This knockout was generated by the National Bioresource Project, Tokyo, Japan, which is part of the International C. elegans Gene Knockout Consortium, which should be acknowledged in any publications resulting from its use. | Paper_evidence | WBPaper00041807 | ||||||
Method | NBP_knockout_allele |